] ] } "action" : "rerender" } { "action" : "rerender" LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ } if (doChecks(pagerId, val)) } "event" : "AcceptSolutionAction", if (element.hasClass('active')) { Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); } watching = false; } { "context" : "", "event" : "expandMessage", "event" : "removeMessageUserEmailSubscription", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); } "event" : "addThreadUserEmailSubscription", "message" : "2046206", } { https://forum.vodafone.de/t5/Mobilfunk/Ungewollte-Kosten-durch-Drittanbieter-vermeiden-Oder-hilf-dir... Dort sind wertvolle Tipps und Hinweise auch wie du das unberechtigte Geld zurückzubekommen. }); { }, } "action" : "rerender" Nun merke ich, dass, wenn ich das mobile Netz benutze, die Kosten vom Guthaben abgezogen werden. ] }, })(LITHIUM.jQuery); } "context" : "", "context" : "", "context" : "", "context" : "envParam:selectedMessage", "linkDisabled" : "false" }, LITHIUM.Dialog({ }, { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }); "context" : "envParam:entity", ] "showCountOnly" : "false", }, "message" : "2046203", } "action" : "rerender" "; Des Weiteren habe ich bewusst am Anfang des Monats die Abosperre für Drittanbieter im Onlinekonto aktiviert, auch wenn ich - wie schon gesagt - keine Abos nutze, da ich prüfen wollte, ob das ggf. ], { }, "action" : "rerender" o.innerHTML = "Page must be an integer number. "message" : "2046122", "context" : "", { "action" : "rerender" { "displayStyle" : "horizontal", { { "context" : "envParam:quiltName,product,contextId,contextUrl", "useSimpleView" : "false", ] Vielleicht ist es noch ein bestehendes Abo das schon vor der Sperrung lief. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BEotVaVUQgpyOIvgnHt5qypGdL9AgPvPlal_xjJ3JlI. "eventActions" : [ })(LITHIUM.jQuery); ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { "event" : "ProductAnswer", "actions" : [ { { "action" : "rerender" } "actions" : [ "action" : "rerender" ] "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", "action" : "rerender" "actions" : [ { ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } "action" : "rerender" } { { }, "actions" : [ "event" : "MessagesWidgetEditCommentForm", ], LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } LITHIUM.Dialog.options['1039065580'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "dialogContentCssClass" : "lia-panel-dialog-content", }, } ] "displaySubject" : "true", { $(document).ready(function(){ "disableLinks" : "false", $(document).ready(function(){ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); }, { "selector" : "#messageview_6", "context" : "", { "actions" : [ "disallowZeroCount" : "false", }, $('li.close-on-click').on('click',resetMenu); } ] }, "action" : "pulsate" "actions" : [ { "useSubjectIcons" : "true", $(this).next().toggle(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); ] Ich hatte also über Nacht plötzlich nur noch die Hälfte von meinem Guthaben auf dem Handy obwohl ich keine SMS geschrieben habe und auch nicht Telefoniert habe. { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "}); "messageViewOptions" : "1111110111111111111110111110100101001101" } ] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "event" : "addMessageUserEmailSubscription", { "actions" : [ "eventActions" : [ LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { "useSimpleView" : "false", { "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { { "}); "context" : "lia-deleted-state", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ }, { ] "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", } "selector" : "#kudosButtonV2_6", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); Prepaid Karte aufgeladen und Guthaben gleich wieder weg ... hatte am 16.2.17 mein Prepaid Guthaben aufgeladen und laut SMS Bestätigung ein Guthaben von 39,57€ Am gleichen Tag wurde meine Telefonie Allnet Flat um 15€ aufgeladen. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_JgNMcZ6Cti3Ic_ogyNPmPZhdWOP8g7QQbgnEZ4fRt4. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } { o.innerHTML = "Page must be in a numeric format. { "actions" : [ ] { }, "kudosable" : "true", ], }, "action" : "pulsate" "context" : "", } "actions" : [ }, } "actions" : [ ] "context" : "", { { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { LITHIUM.Dialog.options['1668672056'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ o.innerHTML = "Page must be an integer number. "actions" : [ $(document).ready(function(){ "linkDisabled" : "false" if ( Number(val) < 1 ) } { "context" : "", "kudosable" : "true", "useTruncatedSubject" : "true", ] ] } } "selector" : "#messageview_3", } ] { }); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2046162 .lia-rating-control-passive', '#form_4'); { "truncateBodyRetainsHtml" : "false", { setWarning(pagerId); } "action" : "rerender" "useSimpleView" : "false", $('#community-menu-toggle').click(function() { "action" : "rerender" if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { } "context" : "envParam:quiltName,message", { }, LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "context" : "", "context" : "", } Execute whatever should happen when entering the right sequence "truncateBody" : "true", } ING. "actions" : [ }); "messageViewOptions" : "1111110111111111111110111110100101001101" { "disableLabelLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'FP5fVbmpF-cJLXUoHtdVZgQD95j-tXM0rQyjy9CS3Z8. }, }, "kudosable" : "true", "action" : "rerender" { { { "event" : "markAsSpamWithoutRedirect", ] LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044970}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045283}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045727}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045935}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046122}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046162}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046183}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046199}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046203}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046206}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508080}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506139}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510469}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509918}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509847}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509650}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509356}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509159}},{"elementId":"link_73","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509134}},{"elementId":"link_75","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508860}},{"elementId":"link_77","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508673}},{"elementId":"link_79","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508534}}]); "actions" : [ "disallowZeroCount" : "false", "useSubjectIcons" : "true", "action" : "pulsate" window.location.replace('/t5/user/userloginpage'); count = 0; "action" : "rerender" "event" : "ProductMessageEdit", "action" : "rerender" "context" : "", "context" : "", $('#community-menu-toggle').click(function() { "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", "event" : "MessagesWidgetEditAnswerForm", { { "context" : "", } "messageViewOptions" : "1111110111111111111110111110100101001101" }, ] ] "}); { if ( watching ) { "event" : "deleteMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "lia-deleted-state", "disableLinks" : "false", "actions" : [ resetMenu(); "event" : "MessagesWidgetEditAction", "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044970}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045283}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045727}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045935}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046122}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046162}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046183}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046199}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046203}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046206}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508080}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506139}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510469}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509918}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509847}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509650}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509356}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509159}},{"elementId":"link_73","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509134}},{"elementId":"link_75","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508860}},{"elementId":"link_77","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508673}},{"elementId":"link_79","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508534}}]); return; "initiatorBinding" : true, "disableLinks" : "false", { "componentId" : "kudos.widget.button", ] "actions" : [ "; ] { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", ] { "action" : "rerender" } "event" : "expandMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2046206,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hJhHmi2VnexrgAcFCv1fGUsqPvouHg299-DoJciKq4o. "actions" : [ }, }, > 0) ) "event" : "MessagesWidgetEditAnswerForm", "context" : "", "useTruncatedSubject" : "true", "actions" : [ "context" : "envParam:quiltName,message", } } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7y_YLJOOw9yB3srcKJhR5k3-cU-xxRFtItej3j1vhH8. { { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "pulsate" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "actions" : [ MMS) vorliegen. "action" : "rerender" "kudosLinksDisabled" : "false", "context" : "", "context" : "", "action" : "rerender" }, } }, { "actions" : [ { { { "action" : "rerender" "action" : "rerender" "actions" : [ } ] "actions" : [ }, "action" : "rerender" } { // Reset the conditions so that someone can do it all again. } "event" : "ProductAnswer", ] "action" : "rerender" "action" : "rerender" ;(function($) { ] "event" : "MessagesWidgetMessageEdit", }, Ich gehöre nicht zu den Leuten die sich hunderte sinnlose Apps (mit Abofallen) runterladen, oder die - ohne nachzudenken - jeden Link in einer Nachricht oder Webseite anklicken, der sie auf Aboseiten bringt, von daher gibt es da keine Abos bei mir.

Zaubertrank Harry Potter, Rigorosum Sowi Graz, Bahnhöfle Staufen Facebook, Elbe Nebenfluss 4 Buchstaben, Zulassungsstelle Singen Termin Machen, Schwarzer Adler Oberbergen Silvestermenü, Fortnite Ports Sperren, Food With Love Champignons,